Lineage for d2bg8a_ (2bg8 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046299Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1046300Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1046301Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1046417Protein automated matches [190079] (4 species)
    not a true protein
  7. 1046418Species Bacillus cereus [TaxId:1396] [187455] (14 PDB entries)
  8. 1046437Domain d2bg8a_: 2bg8 A: [163077]
    automated match to d1bc2a_
    complexed with gol, so4, zn; mutant

Details for d2bg8a_

PDB Entry: 2bg8 (more details), 2.5 Å

PDB Description: bacillus cereus metallo-beta-lactamase (bcii) arg (121) cys mutant. solved at ph4.5 using 20 micromolar znso4 in the buffer. 1mm dtt and 1mm tcep-hcl were used as reducing agents.
PDB Compounds: (A:) beta-lactamase II

SCOPe Domain Sequences for d2bg8a_:

Sequence, based on SEQRES records: (download)

>d2bg8a_ d.157.1.1 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d2bg8a_ d.157.1.1 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfeavpsnglvlntskglvlvdsswddkltkeli
emvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgdlq
tvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvne
wstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d2bg8a_:

Click to download the PDB-style file with coordinates for d2bg8a_.
(The format of our PDB-style files is described here.)

Timeline for d2bg8a_: