Lineage for d2bfza1 (2bfz A:33-281)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996836Species Bacillus cereus [TaxId:1396] [187455] (15 PDB entries)
  8. 2996850Domain d2bfza1: 2bfz A:33-281 [163069]
    Other proteins in same PDB: d2bfza2, d2bfzb2
    automated match to d1bc2a_
    complexed with azi, gol, so4, zn; mutant

Details for d2bfza1

PDB Entry: 2bfz (more details), 2.3 Å

PDB Description: bacillus cereus metallo-beta-lactamase (bcii) arg (121) cys mutant. solved at ph4.5 using 20mm znso4 in buffer. 1mm dtt was used as a reducing agent. cys221 is oxidized.
PDB Compounds: (A:) beta-lactamase II

SCOPe Domain Sequences for d2bfza1:

Sequence, based on SEQRES records: (download)

>d2bfza1 d.157.1.1 (A:33-281) automated matches {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkg

Sequence, based on observed residues (ATOM records): (download)

>d2bfza1 d.157.1.1 (A:33-281) automated matches {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgavpsnglvlntskglvlvdsswddkltkeliemv
ekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgdlqtvt
nlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvnewst
sienvlkryrninavvpghgevgdkg

SCOPe Domain Coordinates for d2bfza1:

Click to download the PDB-style file with coordinates for d2bfza1.
(The format of our PDB-style files is described here.)

Timeline for d2bfza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bfza2