Lineage for d2bfyb_ (2bfy B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983277Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (11 PDB entries)
  8. 2983292Domain d2bfyb_: 2bfy B: [163068]
    automated match to d1ol5a_
    complexed with h1n

Details for d2bfyb_

PDB Entry: 2bfy (more details), 1.8 Å

PDB Description: complex of aurora-b with incenp and hesperadin.
PDB Compounds: (B:) aurora kinase b-a

SCOPe Domain Sequences for d2bfyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bfyb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvyqs

SCOPe Domain Coordinates for d2bfyb_:

Click to download the PDB-style file with coordinates for d2bfyb_.
(The format of our PDB-style files is described here.)

Timeline for d2bfyb_: