Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (12 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (9 PDB entries) |
Domain d2bfxb_: 2bfx B: [163066] automated match to d1ol5a_ |
PDB Entry: 2bfx (more details), 1.8 Å
SCOPe Domain Sequences for d2bfxb_:
Sequence, based on SEQRES records: (download)
>d2bfxb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk dliskllryhppqrlplkgvmehpwvkansrrvlppvyqs
>d2bfxb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} talaempkrkftiddfdigrplgkgnvylarekqnkfimalkvlfksqlekegvehqlrr eieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeel adalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppem iegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdli skllryhppqrlplkgvmehpwvkansrrvlppvyqs
Timeline for d2bfxb_: