Lineage for d2bfxb_ (2bfx B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1673985Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (9 PDB entries)
  8. 1673992Domain d2bfxb_: 2bfx B: [163066]
    automated match to d1ol5a_

Details for d2bfxb_

PDB Entry: 2bfx (more details), 1.8 Å

PDB Description: mechanism of aurora-b activation by incenp and inhibition by hesperadin.
PDB Compounds: (B:) loc398457 protein

SCOPe Domain Sequences for d2bfxb_:

Sequence, based on SEQRES records: (download)

>d2bfxb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvyqs

Sequence, based on observed residues (ATOM records): (download)

>d2bfxb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgnvylarekqnkfimalkvlfksqlekegvehqlrr
eieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeel
adalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppem
iegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdli
skllryhppqrlplkgvmehpwvkansrrvlppvyqs

SCOPe Domain Coordinates for d2bfxb_:

Click to download the PDB-style file with coordinates for d2bfxb_.
(The format of our PDB-style files is described here.)

Timeline for d2bfxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bfxa_