| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein automated matches [190091] (8 species) not a true protein |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (6 PDB entries) |
| Domain d2bfxa_: 2bfx A: [163065] automated match to d1ol5a_ |
PDB Entry: 2bfx (more details), 1.8 Å
SCOPe Domain Sequences for d2bfxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bfxa_ d.144.1.7 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiq
shlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalh
ycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkt
hdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllr
yhppqrlplkgvmehpwvkansrrvlppvyq
Timeline for d2bfxa_: