Lineage for d2bfka_ (2bfk A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603072Species Bacillus cereus [TaxId:1396] [187455] (16 PDB entries)
  8. 2603082Domain d2bfka_: 2bfk A: [163061]
    automated match to d1bc2a_
    complexed with azi, gol, so4, zn; mutant

Details for d2bfka_

PDB Entry: 2bfk (more details), 2 Å

PDB Description: bacillus cereus metallo-beta-lactamase (bcii) arg (121) cys mutant. solved at ph7 using 20mm znso4 in buffer. 1mm dtt was used as a reducing agent
PDB Compounds: (A:) beta-lactamase II

SCOPe Domain Sequences for d2bfka_:

Sequence, based on SEQRES records: (download)

>d2bfka_ d.157.1.1 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d2bfka_ d.157.1.1 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfneavpsnglvlntskglvlvdsswddkltkel
iemvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgdl
qtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvn
ewstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d2bfka_:

Click to download the PDB-style file with coordinates for d2bfka_.
(The format of our PDB-style files is described here.)

Timeline for d2bfka_: