| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries) |
| Domain d2bekb_: 2bek B: [163058] automated match to d1hyqa_ complexed with atp, mg |
PDB Entry: 2bek (more details), 1.8 Å
SCOPe Domain Sequences for d2bekb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bekb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
kvrrialanqkggvgktttainlaaylarlgkrvllvdlapqgnatsglgvraergvyhl
lqgepleglvhpvdgfhllpatpdlvgatvelagaptalrealrdegydlvlldappsls
pltlnalaaaegvvvpvqaeyyalegvagllatleevraglnprlrllgilvtmydgrtl
laqqveaqlrahfgekvfwtviprnvrlaeapsfgktiaqhaptspgahayrrlaeevma
rvqe
Timeline for d2bekb_: