SCOPe 2.01: Domain d2beab_: 2bea B:

Lineage for d2beab_ (2bea B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)

6. Protein automated matches [190504] (2 species)
   not a true protein

7. Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (9 PDB entries)

8. Domain d2beab_: 2bea B: [163053]
   automated match to d1wbca_
   mutant

Details for d2beab_

PDB Entry: 2bea, 2.35 Å

PDB Description: crystal structure of asn14 to gly mutant of wci

PDB Compounds: (B:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d2beab_:

Sequence, based on SEQRES records:

>d2beab_ b.42.4.1 (B:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dlvdaegnlvegggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiriss
qflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfekv
shsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkak

Sequence, based on observed residues (ATOM records):

>d2beab_ b.42.4.1 (B:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dlvdaegnlvegggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiriss
qflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfekv
shsnihvykllycqhvkcdqyigihrdrngnrrlvvteenplelvllkak

Timeline for d2beab_:

• d2beab_ is new in SCOPe 2.01-stable
  
• d2beab_ appears in SCOPe 2.02
  
• d2beab_ appears in the current release, SCOPe 2.08