SCOPe 2.05: Domain d2bdzc_: 2bdz C:

Lineage for d2bdzc_ (2bdz C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (9 species)
   not a true protein

7. Species Jacaratia mexicana [TaxId:309130] [187452] (1 PDB entry)

8. Domain d2bdzc_: 2bdz C: [163050]
   automated match to d1yala_
   complexed with e64

Details for d2bdzc_

PDB Entry: 2bdz, 2.1 Å

PDB Description: mexicain from jacaratia mexicana

PDB Compounds: (C:) Mexicain

SCOPe Domain Sequences for d2bdzc_:

Sequence; same for both SEQRES and ATOM records:

>d2bdzc_ d.3.1.1 (C:) automated matches {Jacaratia mexicana [TaxId: 309130]}
ypesidwrekgavtpvknqnpcgscwafstvatieginkiitgqlislseqelldcerrs
hgcdggyqttslqyvvdngvhtereypyekkqgrcrakdkkgpkvyitgykyvpandeis
liqaianqpvsvvtdsrgrgfqfykggiyegpcgtntdhavtavgygktylllknswgpn
wgekgyirikrasgrskgtcgvytssffpikg

Timeline for d2bdzc_:

• d2bdzc_ first appeared in SCOPe 2.01
  
• d2bdzc_ appears in SCOPe 2.04
  
• d2bdzc_ appears in SCOPe 2.06
  
• d2bdzc_ appears in the current release, SCOPe 2.08