Class a: All alpha proteins [46456] (286 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) duplication: contains two such domains related by pseudo dyad |
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries) identical sequence to Thermus aquaticus, TaxId: 271 |
Domain d1eiyb1: 1eiy B:1-38,B:152-190 [16305] Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6 protein/RNA complex |
PDB Entry: 1eiy (more details), 3.3 Å
SCOPe Domain Sequences for d1eiyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiyb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]} mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg lardlhalgyalvepeaa
Timeline for d1eiyb1: