Lineage for d1eiyb1 (1eiy B:1-38,B:152-190)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724238Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1724239Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1724240Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 1724241Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 1724242Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1724265Domain d1eiyb1: 1eiy B:1-38,B:152-190 [16305]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6
    protein/RNA complex

Details for d1eiyb1

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1eiyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOPe Domain Coordinates for d1eiyb1:

Click to download the PDB-style file with coordinates for d1eiyb1.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb1: