SCOP 1.55: Domain d1eiyb1: 1eiy B:1-38,B:152-190

Lineage for d1eiyb1 (1eiy B:1-38,B:152-190)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries)

8. Domain d1eiyb1: 1eiy B:1-38,B:152-190 [16305]
   Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiyb1

PDB Entry: 1eiy, 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb1:

Sequence; same for both SEQRES and ATOM records:

>d1eiyb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOP Domain Coordinates for d1eiyb1 are not available.

Timeline for d1eiyb1:

• d1eiyb1 appears in SCOP 1.57
  
• d1eiyb1 appears in the current release, SCOPe 2.08