SCOPe 2.01: Domain d2bdzb_: 2bdz B:

Lineage for d2bdzb_ (2bdz B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (8 species)
   not a true protein

7. Species Jacaratia mexicana [TaxId:309130] [187452] (1 PDB entry)

8. Domain d2bdzb_: 2bdz B: [163049]
   automated match to d1yala_
   complexed with e64

Details for d2bdzb_

PDB Entry: 2bdz, 2.1 Å

PDB Description: mexicain from jacaratia mexicana

PDB Compounds: (B:) Mexicain

SCOPe Domain Sequences for d2bdzb_:

Sequence; same for both SEQRES and ATOM records:

>d2bdzb_ d.3.1.1 (B:) automated matches {Jacaratia mexicana [TaxId: 309130]}
ypesidwrekgavtpvknqnpcgscwafstvatieginkiitgqlislseqelldcerrs
hgcdggyqttslqyvvdngvhtereypyekkqgrcrakdkkgpkvyitgykyvpandeis
liqaianqpvsvvtdsrgrgfqfykggiyegpcgtntdhavtavgygktylllknswgpn
wgekgyirikrasgrskgtcgvytssffpikg

Timeline for d2bdzb_:

• d2bdzb_ is new in SCOPe 2.01-stable
  
• d2bdzb_ appears in SCOPe 2.02
  
• d2bdzb_ appears in the current release, SCOPe 2.08