| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
| Protein automated matches [190503] (10 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187451] (6 PDB entries) |
| Domain d2bcmb_: 2bcm B: [163042] automated match to d1rxla_ |
PDB Entry: 2bcm (more details), 1.48 Å
SCOPe Domain Sequences for d2bcmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcmb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tfqasgttgittltvteecrvqvgnvtatlarsklkddtaigvigvtalgcnglqaalqa
dpdnydatnlymtsrnhdklnvklkatdgsswtygngvfykteggnwgghvgisvdgnqt
dkptgeytlnltggywtn
Timeline for d2bcmb_: