Lineage for d2bcmb_ (2bcm B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767842Family b.2.3.0: automated matches [191391] (1 protein)
    not a true family
  6. 2767843Protein automated matches [190503] (10 species)
    not a true protein
  7. 2767867Species Escherichia coli [TaxId:562] [187451] (6 PDB entries)
  8. 2767869Domain d2bcmb_: 2bcm B: [163042]
    automated match to d1rxla_

Details for d2bcmb_

PDB Entry: 2bcm (more details), 1.48 Å

PDB Description: daae adhesin
PDB Compounds: (B:) F1845 fimbrial protein

SCOPe Domain Sequences for d2bcmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcmb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tfqasgttgittltvteecrvqvgnvtatlarsklkddtaigvigvtalgcnglqaalqa
dpdnydatnlymtsrnhdklnvklkatdgsswtygngvfykteggnwgghvgisvdgnqt
dkptgeytlnltggywtn

SCOPe Domain Coordinates for d2bcmb_:

Click to download the PDB-style file with coordinates for d2bcmb_.
(The format of our PDB-style files is described here.)

Timeline for d2bcmb_: