Lineage for d2bcha_ (2bch A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925259Protein Phospholipase A2 [48637] (5 species)
  7. 925260Species Cow (Bos taurus), pancreas [TaxId:9913] [48639] (32 PDB entries)
    Uniprot P00593
  8. 925264Domain d2bcha_: 2bch A: [163040]
    automated match to d1gh4a_
    complexed with ca, cl, mpd; mutant

Details for d2bcha_

PDB Entry: 2bch (more details), 1.1 Å

PDB Description: a possible of second calcium ion in interfacial binding: atomic and medium resolution crystal structures of the quadruple mutant of phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d2bcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcha_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]}
alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
mnc

SCOPe Domain Coordinates for d2bcha_:

Click to download the PDB-style file with coordinates for d2bcha_.
(The format of our PDB-style files is described here.)

Timeline for d2bcha_: