Lineage for d2bbtb_ (2bbt B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870138Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2870139Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
    Uniprot P13569 389-671
  8. 2870169Domain d2bbtb_: 2bbt B: [163035]
    automated match to d1xmid_
    complexed with atp, mg; mutant

Details for d2bbtb_

PDB Entry: 2bbt (more details), 2.3 Å

PDB Description: human deltaf508 nbd1 with two solublizing mutations.
PDB Compounds: (B:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d2bbtb_:

Sequence, based on SEQRES records: (download)

>d2bbtb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweegfgelfekakqnnnnrktsngddslffsnfsllgtpvlkdinfki
ergqllavagstgagktsllmmimgelepsegkikhsgrisfcsqnswimpgtikeniig
vsydeyryrsvikacqleediskfaekdnivlgeggitlsggqrarislaravykdadly
lldspfgyldvltekeifescvcklmanktrilvtskmehlkkadkililhegssyfygt
fselqnlrpdfssklmgcdsfdqfsaerrnsiltetlhrfsl

Sequence, based on observed residues (ATOM records): (download)

>d2bbtb_ c.37.1.12 (B:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweegfgelfekakqnnnntpvlkdinfkiergqllavagstgagktsl
lmmimgelepsegkikhsgrisfcsqnswimpgtikeniigvsydeyryrsvikacqlee
diskfaekdnivlgitlsggqrarislaravykdadlylldspfgyldvltekeifescv
cklmanktrilvtskmehlkkadkililhegssyfygtfselqnlrpdfssklmdsfdqf
saerrnsiltetlhrfsl

SCOPe Domain Coordinates for d2bbtb_:

Click to download the PDB-style file with coordinates for d2bbtb_.
(The format of our PDB-style files is described here.)

Timeline for d2bbtb_: