Lineage for d1b70b1 (1b70 B:1-38,B:152-190)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is differentSuperfamily a.6.1: Putative DNA-binding domain [46955] (8 families) 
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
duplication: contains two such domains related by pseudo dyadProtein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1b70b1: 1b70 B:1-38,B:152-190 [16303]
Other proteins in same PDB: d1b70a_, d1b70b3, d1b70b4, d1b70b5, d1b70b6
protein/RNA complex; complexed with mg, phe
Details for d1b70b1
PDB Entry: 1b70 (more details), 2.7 Å
PDB Description: phenylalanyl trna synthetase complexed with phenylalanine
PDB Compounds: (B:) phenylalanyl-tRNA synthetaseSCOPe Domain Sequences for d1b70b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b70b1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa
SCOPe Domain Coordinates for d1b70b1:
Click to download the PDB-style file with coordinates for d1b70b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b70b1:
View in 3D
