SCOP 1.63: Domain d1b70b1: 1b70 B:1-38,B:152-190

Lineage for d1b70b1 (1b70 B:1-38,B:152-190)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   dulication: contains two such domains related by pseudodyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)

8. Domain d1b70b1: 1b70 B:1-38,B:152-190 [16303]
   Other proteins in same PDB: d1b70a_, d1b70b3, d1b70b4, d1b70b5, d1b70b6

Details for d1b70b1

PDB Entry: 1b70, 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70b1:

Sequence; same for both SEQRES and ATOM records:

>d1b70b1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

Timeline for d1b70b1:

• d1b70b1 first appeared (with stable ids) in SCOP 1.55
  
• d1b70b1 appears in SCOP 1.61
  
• d1b70b1 appears in SCOP 1.65
  
• d1b70b1 appears in the current release, SCOPe 2.08