Lineage for d1b70b1 (1b70 B:1-38,B:152-190)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45974Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 45975Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) (S)
  5. 45976Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
  6. 45977Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 45978Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries)
  8. 45983Domain d1b70b1: 1b70 B:1-38,B:152-190 [16303]
    Other proteins in same PDB: d1b70a_, d1b70b3, d1b70b4, d1b70b5, d1b70b6

Details for d1b70b1

PDB Entry: 1b70 (more details), 2.7 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalanine

SCOP Domain Sequences for d1b70b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b70b1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOP Domain Coordinates for d1b70b1:

Click to download the PDB-style file with coordinates for d1b70b1.
(The format of our PDB-style files is described here.)

Timeline for d1b70b1: