SCOPe 2.04: Domain d1b7yb2: 1b7y B:400-474

Lineage for d1b7yb2 (1b7y B:400-474)

Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds)
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
duplication: contains two such domains related by pseudo dyad
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1b7yb2: 1b7y B:400-474 [16302]
Other proteins in same PDB: d1b7ya_, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6
protein/RNA complex; complexed with fya, mg

Details for d1b7yb2

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

PDB Compounds: (B:) protein (phenylalanyl-tRNA synthetase)

SCOPe Domain Sequences for d1b7yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOPe Domain Coordinates for d1b7yb2:

Click to download the PDB-style file with coordinates for d1b7yb2.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb2: