SCOP 1.57: Domain d1b7yb2: 1b7y B:400-474

Lineage for d1b7yb2 (1b7y B:400-474)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries)

8. Domain d1b7yb2: 1b7y B:400-474 [16302]
   Other proteins in same PDB: d1b7ya_, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6

Details for d1b7yb2

PDB Entry: 1b7y, 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb2:

Sequence; same for both SEQRES and ATOM records:

>d1b7yb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

Timeline for d1b7yb2:

• d1b7yb2 first appeared (with stable ids) in SCOP 1.55
  
• d1b7yb2 appears in SCOP 1.59
  
• d1b7yb2 appears in the current release, SCOPe 2.08