| Class a: All alpha proteins [46456] (138 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) |
Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) ![]() |
| Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) |
| Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
| Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries) |
| Domain d1b7yb2: 1b7y B:400-474 [16302] Other proteins in same PDB: d1b7ya_, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6 |
PDB Entry: 1b7y (more details), 2.5 Å
SCOP Domain Sequences for d1b7yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7yb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl
Timeline for d1b7yb2: