Lineage for d1b7yb1 (1b7y B:1-38,B:152-190)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724238Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1724239Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1724240Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 1724241Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 1724242Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 1724251Domain d1b7yb1: 1b7y B:1-38,B:152-190 [16301]
    Other proteins in same PDB: d1b7ya_, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6
    protein/RNA complex; complexed with fya, mg

Details for d1b7yb1

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate
PDB Compounds: (B:) protein (phenylalanyl-tRNA synthetase)

SCOPe Domain Sequences for d1b7yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOPe Domain Coordinates for d1b7yb1:

Click to download the PDB-style file with coordinates for d1b7yb1.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb1: