Lineage for d1b7yb1 (1b7y B:1-38,B:152-190)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278568Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 278569Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 278570Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    dulication: contains two such domains related by pseudo dyad
  6. 278571Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 278572Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)
  8. 278577Domain d1b7yb1: 1b7y B:1-38,B:152-190 [16301]
    Other proteins in same PDB: d1b7ya_, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6

Details for d1b7yb1

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOP Domain Coordinates for d1b7yb1:

Click to download the PDB-style file with coordinates for d1b7yb1.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb1: