Lineage for d1b7yb1 (1b7y B:1-38,B:152-190)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1817Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 1818Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) (S)
  5. 1819Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
  6. 1820Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 1821Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries)
  8. 1824Domain d1b7yb1: 1b7y B:1-38,B:152-190 [16301]
    Other proteins in same PDB: d1b7ya_, d1b7yb3, d1b7yb4, d1b7yb5, d1b7yb6

Details for d1b7yb1

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

SCOP Domain Sequences for d1b7yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOP Domain Coordinates for d1b7yb1:

Click to download the PDB-style file with coordinates for d1b7yb1.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb1: