Lineage for d2b8hd_ (2b8h D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959827Protein automated matches [190279] (4 species)
    not a true protein
  7. 959843Species Influenza A virus [TaxId:11320] [187447] (5 PDB entries)
  8. 959851Domain d2b8hd_: 2b8h D: [163005]
    automated match to d1a14n_
    complexed with cl, gol, nag, so4

Details for d2b8hd_

PDB Entry: 2b8h (more details), 2.2 Å

PDB Description: A/NWS/whale/Maine/1/84 (H1N9) reassortant influenza virus neuraminidase
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d2b8hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8hd_ b.68.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisvasrsgyemlkvpn
altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnwpdgakieyfl

SCOPe Domain Coordinates for d2b8hd_:

Click to download the PDB-style file with coordinates for d2b8hd_.
(The format of our PDB-style files is described here.)

Timeline for d2b8hd_: