Lineage for d2b8hb_ (2b8h B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2074755Protein Influenza neuraminidase [50943] (4 species)
  7. 2074766Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2074792Domain d2b8hb_: 2b8h B: [163003]
    automated match to d1a14n_
    complexed with cl, gol, nag, so4

Details for d2b8hb_

PDB Entry: 2b8h (more details), 2.2 Å

PDB Description: a/nws/whale/maine/1/84 (h1n9) reassortant influenza virus neuraminidase
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d2b8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b8hb_ b.68.1.1 (B:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisvasrsgyemlkvpn
altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnwpdgakieyfl

SCOPe Domain Coordinates for d2b8hb_:

Click to download the PDB-style file with coordinates for d2b8hb_.
(The format of our PDB-style files is described here.)

Timeline for d2b8hb_: