Lineage for d1pysb2 (1pys B:400-474)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) 
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries) 
Domain d1pysb2: 1pys B:400-474 [16300]
Other proteins in same PDB: d1pysa_, d1pysb3, d1pysb4, d1pysb5, d1pysb6
Details for d1pysb2
PDB Entry: 1pys (more details), 2.9 Å
PDB Description: phenylalanyl-trna synthetase from thermus thermophilus
SCOP Domain Sequences for d1pysb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pysb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl
SCOP Domain Coordinates for d1pysb2:
Click to download the PDB-style file with coordinates for d1pysb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pysb2:
- d1pysb2 appears in SCOP 1.57
- d1pysb2 appears in the current release, SCOPe 2.08
View in 3D
