Lineage for d2b5sb_ (2b5s B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737146Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 1737147Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 1737148Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 1737191Protein automated matches [190480] (3 species)
    not a true protein
  7. 1737195Species Prunus persica [TaxId:3760] [187408] (2 PDB entries)
  8. 1737199Domain d2b5sb_: 2b5s B: [162994]
    automated match to d1afha_
    complexed with dao, hp6, so4

Details for d2b5sb_

PDB Entry: 2b5s (more details), 2.35 Å

PDB Description: Crystal structure of peach Pru p3, the prototypic member of the family of plant non-specific lipid transfer protein pan-allergens
PDB Compounds: (B:) non-specific lipid transfer protein

SCOPe Domain Sequences for d2b5sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5sb_ a.52.1.1 (B:) automated matches {Prunus persica [TaxId: 3760]}
mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp
gvnpnnaaalpgkcgvsipykisastncatvk

SCOPe Domain Coordinates for d2b5sb_:

Click to download the PDB-style file with coordinates for d2b5sb_.
(The format of our PDB-style files is described here.)

Timeline for d2b5sb_: