![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
![]() | Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) ![]() can be classified as disulfide-rich |
![]() | Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins) |
![]() | Protein automated matches [190480] (4 species) not a true protein |
![]() | Species Prunus persica [TaxId:3760] [187408] (2 PDB entries) |
![]() | Domain d2b5sb_: 2b5s B: [162994] automated match to d1afha_ complexed with dao, hp6, so4 |
PDB Entry: 2b5s (more details), 2.35 Å
SCOPe Domain Sequences for d2b5sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b5sb_ a.52.1.1 (B:) automated matches {Prunus persica [TaxId: 3760]} mitcgqvssslapcipyvrgggavppaccngirnvnnlarttpdrqaacnclkqlsasvp gvnpnnaaalpgkcgvsipykisastncatvk
Timeline for d2b5sb_: