SCOPe 2.05: Domain d2b3rb_: 2b3r B:

Lineage for d2b3rb_ (2b3r B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.0: automated matches [191388] (1 protein)
   not a true family

6. Protein automated matches [190497] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187441] (3 PDB entries)

8. Domain d2b3rb_: 2b3r B: [162990]
   automated match to d2bwqa1
   complexed with so4

Details for d2b3rb_

PDB Entry: 2b3r, 2.3 Å

PDB Description: Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2

PDB Compounds: (B:) Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide

SCOPe Domain Sequences for d2b3rb_:

Sequence; same for both SEQRES and ATOM records:

>d2b3rb_ b.7.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrkt
rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwy
qlta

Timeline for d2b3rb_:

• d2b3rb_ first appeared in SCOPe 2.01
  
• d2b3rb_ appears in SCOPe 2.04
  
• d2b3rb_ is called d2b3rb1 in SCOPe 2.06
  
• d2b3rb_ appears in the current release, SCOPe 2.08, called d2b3rb1