SCOPe 2.03: Domain d1pysb1: 1pys B:1-38,B:152-190

Lineage for d1pysb1 (1pys B:1-38,B:152-190)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
   duplication: contains two such domains related by pseudo dyad

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46958] (11 PDB entries)
   identical sequence to Thermus aquaticus, TaxId: 271

8. Domain d1pysb1: 1pys B:1-38,B:152-190 [16299]
   Other proteins in same PDB: d1pysa_, d1pysb3, d1pysb4, d1pysb5, d1pysb6
   complexed with mg

Details for d1pysb1

PDB Entry: 1pys, 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1pysb1:

Sequence; same for both SEQRES and ATOM records:

>d1pysb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

Timeline for d1pysb1:

• d1pysb1 first appeared (with stable ids) in SCOP 1.55
  
• d1pysb1 appears in SCOPe 2.02
  
• d1pysb1 appears in SCOPe 2.04
  
• d1pysb1 appears in the current release, SCOPe 2.08