Lineage for d1pysb1 (1pys B:1-38,B:152-190)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696353Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 2696354Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 2696355Species Thermus thermophilus [TaxId:274] [46958] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2696358Domain d1pysb1: 1pys B:1-38,B:152-190 [16299]
    Other proteins in same PDB: d1pysa_, d1pysb3, d1pysb4, d1pysb5, d1pysb6
    complexed with mg

Details for d1pysb1

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1pysb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysb1 a.6.1.1 (B:1-38,B:152-190) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
mrvpfswlkayvpelespevleerlaglgfetdriervXeevvldlevtpnrpdalgllg
lardlhalgyalvepeaa

SCOPe Domain Coordinates for d1pysb1:

Click to download the PDB-style file with coordinates for d1pysb1.
(The format of our PDB-style files is described here.)

Timeline for d1pysb1: