Lineage for d2b3ra1 (2b3r A:1384-1505)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773128Species Mouse (Mus musculus) [TaxId:10090] [187441] (4 PDB entries)
  8. 2773130Domain d2b3ra1: 2b3r A:1384-1505 [162989]
    Other proteins in same PDB: d2b3ra2, d2b3rb2
    automated match to d2bwqa1
    complexed with so4

Details for d2b3ra1

PDB Entry: 2b3r (more details), 2.3 Å

PDB Description: Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2
PDB Compounds: (A:) Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide

SCOPe Domain Sequences for d2b3ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3ra1 b.7.1.0 (A:1384-1505) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrktrn
ptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwyql
ta

SCOPe Domain Coordinates for d2b3ra1:

Click to download the PDB-style file with coordinates for d2b3ra1.
(The format of our PDB-style files is described here.)

Timeline for d2b3ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b3ra2