| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
| Protein automated matches [190497] (4 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187441] (4 PDB entries) |
| Domain d2b3ra1: 2b3r A:1384-1505 [162989] Other proteins in same PDB: d2b3ra2, d2b3rb2 automated match to d2bwqa1 complexed with so4 |
PDB Entry: 2b3r (more details), 2.3 Å
SCOPe Domain Sequences for d2b3ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b3ra1 b.7.1.0 (A:1384-1505) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrktrn
ptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwyql
ta
Timeline for d2b3ra1: