Lineage for d2b3qd_ (2b3q D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940415Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries)
  8. 2940466Domain d2b3qd_: 2b3q D: [162988]
    automated match to d1qyoa_
    complexed with mg

Details for d2b3qd_

PDB Entry: 2b3q (more details), 2.3 Å

PDB Description: crystal structure of a well-folded variant of green fluorescent protein
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d2b3qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3qd_ d.22.1.1 (D:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith

SCOPe Domain Coordinates for d2b3qd_:

Click to download the PDB-style file with coordinates for d2b3qd_.
(The format of our PDB-style files is described here.)

Timeline for d2b3qd_: