SCOPe 2.06: Domain d2b34f_: 2b34 F:

Lineage for d2b34f_ (2b34 F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (22 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187443] (1 PDB entry)

8. Domain d2b34f_: 2b34 F: [162981]
   automated match to d1x9ga_

Details for d2b34f_

PDB Entry: 2b34, 2.14 Å

PDB Description: Structure of MAR1 Ribonuclease from Caenorhabditis elegans

PDB Compounds: (F:) MAR1 Ribonuclease

SCOPe Domain Sequences for d2b34f_:

Sequence; same for both SEQRES and ATOM records:

>d2b34f_ c.33.1.0 (F:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
arinptnsalfvcdlqekfasnikyfpeiittsrrlidaarilsiptivteqypkglght
vptlkeglaentpifdktkfsmcipptedtlkkvqnvilvgieahvcvlqttydllergl
nvhvvvdavssrshtdrhfafkqmeqagailttseatilglvggsdhpkfkevqklilts
apdtglvplskl

Timeline for d2b34f_:

• d2b34f_ first appeared in SCOPe 2.01
  
• d2b34f_ appears in SCOPe 2.05
  
• d2b34f_ appears in SCOPe 2.07
  
• d2b34f_ appears in the current release, SCOPe 2.08