SCOPe 2.08: Domain d1eija_: 1eij A:

Lineage for d1eija_ (1eij A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.6: Double-stranded DNA-binding domain [46950] (1 family)
   automatically mapped to Pfam PF01984

5. Family a.5.6.1: Double-stranded DNA-binding domain [46951] (2 proteins)

6. Protein Hypothetical protein MTH1615 [46952] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [46953] (1 PDB entry)

8. Domain d1eija_: 1eij A: [16298]
   structural genomics

Details for d1eija_

PDB Entry: 1eij

PDB Description: nmr ensemble of methanobacterium thermoautotrophicum protein 1615

PDB Compounds: (A:) hypothetical protein mth1615

SCOPe Domain Sequences for d1eija_:

Sequence; same for both SEQRES and ATOM records:

>d1eija_ a.5.6.1 (A:) Hypothetical protein MTH1615 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mrqqlemqkkqimmqiltpearsrlanlrltrpdfveqielqliqlaqmgrvrskitdeq
lkellkrvagkk

Timeline for d1eija_:

• d1eija_ first appeared (with stable ids) in SCOP 1.55
  
• d1eija_ appears in SCOPe 2.07