Lineage for d1eija_ (1eij A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696285Superfamily a.5.6: Double-stranded DNA-binding domain [46950] (1 family) (S)
    automatically mapped to Pfam PF01984
  5. 2696286Family a.5.6.1: Double-stranded DNA-binding domain [46951] (2 proteins)
  6. 2696287Protein Hypothetical protein MTH1615 [46952] (1 species)
  7. 2696288Species Methanobacterium thermoautotrophicum [TaxId:145262] [46953] (1 PDB entry)
  8. 2696289Domain d1eija_: 1eij A: [16298]
    structural genomics

Details for d1eija_

PDB Entry: 1eij (more details)

PDB Description: nmr ensemble of methanobacterium thermoautotrophicum protein 1615
PDB Compounds: (A:) hypothetical protein mth1615

SCOPe Domain Sequences for d1eija_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eija_ a.5.6.1 (A:) Hypothetical protein MTH1615 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mrqqlemqkkqimmqiltpearsrlanlrltrpdfveqielqliqlaqmgrvrskitdeq
lkellkrvagkk

SCOPe Domain Coordinates for d1eija_:

Click to download the PDB-style file with coordinates for d1eija_.
(The format of our PDB-style files is described here.)

Timeline for d1eija_: