![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
![]() | Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
![]() | Protein automated matches [190499] (6 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187443] (1 PDB entry) |
![]() | Domain d2b34a_: 2b34 A: [162976] automated match to d1x9ga_ |
PDB Entry: 2b34 (more details), 2.14 Å
SCOPe Domain Sequences for d2b34a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b34a_ c.33.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} arinptnsalfvcdlqekfasnikyfpeiittsrrlidaarilsiptivteqypkglght vptlkeglaentpifdktkfsmcipptedtlkkvqnvilvgieahvcvlqttydllergl nvhvvvdavssrshtdrhfafkqmeqagailttseatilglvggsdhpkfkevqklilts apdtglvplskl
Timeline for d2b34a_: