SCOPe 2.01: Domain d2b34a_: 2b34 A:

Lineage for d2b34a_ (2b34 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (6 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187443] (1 PDB entry)

8. Domain d2b34a_: 2b34 A: [162976]
   automated match to d1x9ga_

Details for d2b34a_

PDB Entry: 2b34, 2.14 Å

PDB Description: Structure of MAR1 Ribonuclease from Caenorhabditis elegans

PDB Compounds: (A:) MAR1 Ribonuclease

SCOPe Domain Sequences for d2b34a_:

Sequence; same for both SEQRES and ATOM records:

>d2b34a_ c.33.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
arinptnsalfvcdlqekfasnikyfpeiittsrrlidaarilsiptivteqypkglght
vptlkeglaentpifdktkfsmcipptedtlkkvqnvilvgieahvcvlqttydllergl
nvhvvvdavssrshtdrhfafkqmeqagailttseatilglvggsdhpkfkevqklilts
apdtglvplskl

Timeline for d2b34a_:

• d2b34a_ is new in SCOPe 2.01-stable
  
• d2b34a_ appears in SCOPe 2.02
  
• d2b34a_ appears in the current release, SCOPe 2.07