Lineage for d2b2dc_ (2b2d C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1916511Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1916512Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1916513Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1916655Protein automated matches [190495] (3 species)
    not a true protein
  7. 1916663Species Enterobacteria phage [TaxId:12022] [187438] (2 PDB entries)
  8. 1916669Domain d2b2dc_: 2b2d C: [162975]
    automated match to d1u1ya_
    protein/RNA complex; mutant

Details for d2b2dc_

PDB Entry: 2b2d (more details), 2.9 Å

PDB Description: rna stemloop operator from bacteriophage qbeta complexed with an n87s, e89k mutant ms2 capsid
PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d2b2dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b2dc_ d.85.1.1 (C:) automated matches {Enterobacteria phage [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylsmkltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d2b2dc_:

Click to download the PDB-style file with coordinates for d2b2dc_.
(The format of our PDB-style files is described here.)

Timeline for d2b2dc_: