Lineage for d2b1ea_ (2b1e A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007926Superfamily a.118.17: Cullin repeat-like [74788] (3 families) (S)
  5. 2007936Family a.118.17.2: Exocyst complex component [140851] (3 protein domains)
    includes Pfam PF03081
  6. 2007944Protein automated matches [190494] (1 species)
    not a true protein
  7. 2007945Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187436] (1 PDB entry)
  8. 2007946Domain d2b1ea_: 2b1e A: [162964]
    automated match to d2b7ma1

Details for d2b1ea_

PDB Entry: 2b1e (more details), 2 Å

PDB Description: The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
PDB Compounds: (A:) Exocyst complex component EXO70

SCOPe Domain Sequences for d2b1ea_:

Sequence, based on SEQRES records: (download)

>d2b1ea_ a.118.17.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlnsvasvkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsgqanreense
fhgilthleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswil
dyfhgnsegsiiqdilvgersklilkcmaflepfakeistaknapyekgssgmnsyteal
lgfianekslvddlysqyteskphvlsqilsplisayaklfganlkivrsnlenfgffsf
elvesindvkkslrgkelqnynllqdctqevrqvtqslfrdaidriikkansistipsnn
gvteatvdtmsrlrkfseykngclgamdnitrenwlpsnykekeytlqnealnwedhnvl
lscfisdcidtlavnlerkaqialmpnqepdvanpnssknkhkqrigffilmnltlveqi
vekselnlmlageghsrlerlkkryisymvsdwrdltanlmdsvfidssgkkskdkeqik
ekfrkfnegfedlvsktkqyklsdpslkvtlkseiislvmpmyerfysrykdsfknprkh
ikytpdelttvlnqlvr

Sequence, based on observed residues (ATOM records): (download)

>d2b1ea_ a.118.17.2 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tlnsvasvkdlaneaskyeiilqkginqvglkqytqvvhklddmlediqsreensefhgi
lthleqlikrseaqlrvyfisilnsikpfdpqinitkkmpfpyyedqqlgalswildyfh
gnsegsiiqdilvgersklilkcmaflepfakgssgmnsyteallgfianekslvddlys
qyteskphvlsqilsplisayaklfganlkivrfgffsfelvesindvkkslrgkelqny
nllqdctqevrqvtqslfrdaidriikkansistipsnngvteatvdtmsrlrkfseykn
gclgamdnitrenwlpsnykekeytlqnwedhnvllscfisdcidtlavnlerkaqialm
pnqepdvanpnssknkhkqrigffilmnltlveqivekselnlmlageghsrlerlkkry
isymvsdwrdltanlmdsvfidssgkkskdkeqikekfrkfnegfedlvsktkqyklsdp
slkvtlkseiislvmpmyerfysrykdsfknprkhikytpdelttvlnqlvr

SCOPe Domain Coordinates for d2b1ea_:

Click to download the PDB-style file with coordinates for d2b1ea_.
(The format of our PDB-style files is described here.)

Timeline for d2b1ea_: