![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
![]() | Protein Ribosomal protein S13 [46948] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46949] (18 PDB entries) |
![]() | Domain d1hnwm_: 1hnw M: [16296] Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_ complexed with mg, tac, zn |
PDB Entry: 1hnw (more details), 3.4 Å
SCOP Domain Sequences for d1hnwm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnwm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus} ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk kaprk
Timeline for d1hnwm_: