Lineage for d1hnwm_ (1hnw M:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218644Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 218645Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 218646Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
  6. 218647Protein Ribosomal protein S13 [46948] (1 species)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  7. 218648Species Thermus thermophilus [TaxId:274] [46949] (14 PDB entries)
  8. 218654Domain d1hnwm_: 1hnw M: [16296]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwm_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1hnwm_:

Click to download the PDB-style file with coordinates for d1hnwm_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwm_: