SCOPe 2.05: Domain d2b05b_: 2b05 B:

Lineage for d2b05b_ (2b05 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries)

8. Domain d2b05b_: 2b05 B: [162956]
   automated match to d1qjaa_

Details for d2b05b_

PDB Entry: 2b05, 2.55 Å

PDB Description: Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide

PDB Compounds: (B:) 14-3-3 protein gamma

SCOPe Domain Sequences for d2b05b_:

Sequence; same for both SEQRES and ATOM records:

>d2b05b_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdreqlvqkarlaeqaeryddmaaamknvtelneplsneernllsvayknvvgarrsswr
vissieqktsadgnekkiemvrayrekiekeleavcqdvlslldnylikncsetqyeskv
fylkmkgdyyrylaevatgekratvvessekayseaheiskehmqpthpirlglalnysv
fyyeiqnapeqachlaktafddaiaeldtlnedsykdstlimqllrdnltlwt

Timeline for d2b05b_:

• d2b05b_ first appeared in SCOPe 2.01
  
• d2b05b_ appears in SCOPe 2.04
  
• d2b05b_ appears in SCOPe 2.06
  
• d2b05b_ appears in the current release, SCOPe 2.08