Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (13 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [187433] (1 PDB entry) |
Domain d2azpa_: 2azp A: [162951] automated match to d1tm0a_ |
PDB Entry: 2azp (more details), 2.13 Å
SCOPe Domain Sequences for d2azpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azpa_ d.21.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ghmqririidshtggeptrlviggfpdlgqgdmaerrrllgerhdawraacileprgsdv lvgallcapvdpeacagviffnnsgylgmcghgtiglvaslahlgrigpgvhrietpvge veatlhedgsvsvrnvpayryrrqvsvevpgigrvsgdiawggnwfflvaghgqrlagdn ldaltaytvavqqalddqdirgedggaidhielfaddphadsrnfvlcpgkaydrspcgt gtsaklaclaadgkllpgqpwrqasvigsqfegryewldgqpggpivptirgrahvsaea tllladddpfawgirrgs
Timeline for d2azpa_: