SCOPe 2.05: Domain d2azpa_: 2azp A:

Lineage for d2azpa_ (2azp A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187433] (1 PDB entry)

8. Domain d2azpa_: 2azp A: [162951]
   automated match to d1tm0a_

Details for d2azpa_

PDB Entry: 2azp, 2.13 Å

PDB Description: crystal structure of pa1268 solved by sulfur sad

PDB Compounds: (A:) hypothetical protein PA1268

SCOPe Domain Sequences for d2azpa_:

Sequence; same for both SEQRES and ATOM records:

>d2azpa_ d.21.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ghmqririidshtggeptrlviggfpdlgqgdmaerrrllgerhdawraacileprgsdv
lvgallcapvdpeacagviffnnsgylgmcghgtiglvaslahlgrigpgvhrietpvge
veatlhedgsvsvrnvpayryrrqvsvevpgigrvsgdiawggnwfflvaghgqrlagdn
ldaltaytvavqqalddqdirgedggaidhielfaddphadsrnfvlcpgkaydrspcgt
gtsaklaclaadgkllpgqpwrqasvigsqfegryewldgqpggpivptirgrahvsaea
tllladddpfawgirrgs

Timeline for d2azpa_:

• d2azpa_ first appeared in SCOPe 2.01
  
• d2azpa_ appears in SCOPe 2.04
  
• d2azpa_ is called d2azpa1 in SCOPe 2.06
  
• d2azpa_ appears in the current release, SCOPe 2.08, called d2azpa1