SCOPe 2.08: Domain d2azpa1: 2azp A:1-314

Lineage for d2azpa1 (2azp A:1-314)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187433] (1 PDB entry)

8. Domain d2azpa1: 2azp A:1-314 [162951]
   Other proteins in same PDB: d2azpa2, d2azpa3
   automated match to d1tm0a_

Details for d2azpa1

PDB Entry: 2azp, 2.13 Å

PDB Description: crystal structure of pa1268 solved by sulfur sad

PDB Compounds: (A:) hypothetical protein PA1268

SCOPe Domain Sequences for d2azpa1:

Sequence; same for both SEQRES and ATOM records:

>d2azpa1 d.21.1.0 (A:1-314) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mqririidshtggeptrlviggfpdlgqgdmaerrrllgerhdawraacileprgsdvlv
gallcapvdpeacagviffnnsgylgmcghgtiglvaslahlgrigpgvhrietpvgeve
atlhedgsvsvrnvpayryrrqvsvevpgigrvsgdiawggnwfflvaghgqrlagdnld
altaytvavqqalddqdirgedggaidhielfaddphadsrnfvlcpgkaydrspcgtgt
saklaclaadgkllpgqpwrqasvigsqfegryewldgqpggpivptirgrahvsaeatl
lladddpfawgirr

Timeline for d2azpa1:

• d2azpa1 first appeared in SCOPe 2.01, called d2azpa_
  
• d2azpa1 appears in SCOPe 2.07