Class a: All alpha proteins [46456] (286 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
Protein automated matches [190489] (5 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [187431] (1 PDB entry) |
Domain d2azla_: 2azl A: [162950] automated match to d1v4ea_ mutant |
PDB Entry: 2azl (more details), 2.8 Å
SCOPe Domain Sequences for d2azla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azla_ a.128.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsaehtveeignnkl rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen rdwsglmsfmrekgilkeceetlkvlvknviienswlrd
Timeline for d2azla_: