Lineage for d2azla_ (2azl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731438Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2731503Protein automated matches [190489] (5 species)
    not a true protein
  7. 2731593Species Thermotoga maritima [TaxId:2336] [187431] (1 PDB entry)
  8. 2731594Domain d2azla_: 2azl A: [162950]
    automated match to d1v4ea_
    mutant

Details for d2azla_

PDB Entry: 2azl (more details), 2.8 Å

PDB Description: crystal structure for the mutant f117e of thermotoga maritima octaprenyl pyrophosphate synthase
PDB Compounds: (A:) octoprenyl-diphosphate synthase

SCOPe Domain Sequences for d2azla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azla_ a.128.1.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
nsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaissla
alelvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsaehtveeignnkl
rraflnvigkmseaelieqlsrykpitkeeylrivegksgalfglalqlpallegelged
lynlgvtigtiyqmfddimdfagmekigkdgfldlkngvasfplvtamekfpearqmfen
rdwsglmsfmrekgilkeceetlkvlvknviienswlrd

SCOPe Domain Coordinates for d2azla_:

Click to download the PDB-style file with coordinates for d2azla_.
(The format of our PDB-style files is described here.)

Timeline for d2azla_: