Lineage for d1hnzm_ (1hnz M:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45908Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
  4. 45955Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) (S)
  5. 45956Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein)
  6. 45957Protein Ribosomal protein S13 [46948] (1 species)
  7. 45958Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries)
  8. 45962Domain d1hnzm_: 1hnz M: [16295]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_

Details for d1hnzm_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzm_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1hnzm_:

Click to download the PDB-style file with coordinates for d1hnzm_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzm_: