SCOPe 2.01: Domain d2ayda_: 2ayd A:

Lineage for d2ayda_ (2ayd A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.79: WRKY DNA-binding domain [118289] (1 superfamily)
   zinc-bound 4-stranded meander beta-sheet, distinct from the beta-ribbon motifs

4. Superfamily g.79.1: WRKY DNA-binding domain [118290] (2 families)

5. Family g.79.1.0: automated matches [191385] (1 protein)
   not a true family

6. Protein automated matches [190488] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187430] (1 PDB entry)

8. Domain d2ayda_: 2ayd A: [162944]
   automated match to d1wj2a_
   complexed with sin, zn

Details for d2ayda_

PDB Entry: 2ayd, 1.6 Å

PDB Description: crystal structure of the c-terminal wrky domainof atwrky1, an sa- induced and partially npr1-dependent transcription factor

PDB Compounds: (A:) WRKY transcription factor 1

SCOPe Domain Sequences for d2ayda_:

Sequence; same for both SEQRES and ATOM records:

>d2ayda_ g.79.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srivvhtqtlfdivndgyrwrkygqksvkgspyprsyyrcsspgcpvkkhversshdtkl
littyegkhdhdmppg

Timeline for d2ayda_:

• d2ayda_ is new in SCOPe 2.01-stable
  
• d2ayda_ appears in SCOPe 2.02
  
• d2ayda_ appears in the current release, SCOPe 2.08