![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.79: WRKY DNA-binding domain [118289] (1 superfamily) zinc-bound 4-stranded meander beta-sheet, distinct from the beta-ribbon motifs |
![]() | Superfamily g.79.1: WRKY DNA-binding domain [118290] (2 families) ![]() |
![]() | Family g.79.1.0: automated matches [191385] (1 protein) not a true family |
![]() | Protein automated matches [190488] (1 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187430] (4 PDB entries) |
![]() | Domain d2ayda_: 2ayd A: [162944] automated match to d1wj2a_ complexed with sin, zn |
PDB Entry: 2ayd (more details), 1.6 Å
SCOPe Domain Sequences for d2ayda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayda_ g.79.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} srivvhtqtlfdivndgyrwrkygqksvkgspyprsyyrcsspgcpvkkhversshdtkl littyegkhdhdmppg
Timeline for d2ayda_: